Home Tools
Log in
Cart

ATG1 Protein, Candida glabrata, Recombinant (His)

Catalog No. TMPH-00340
Synonyms: Autophagy-related protein 1, Serine/threonine-protein kinase ATG1, ATG1

Serine/threonine protein kinase involved in the cytoplasm to vacuole transport (Cvt) and found to be essential in autophagy, where it is required for the formation of autophagosomes. Involved in the clearance of protein aggregates which cannot be efficiently cleared by the proteasome. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Also involved in endoplasmic reticulum-specific autophagic process, in selective removal of ER-associated degradation (ERAD) substrates. Plays a key role in ATG9 and ATG23 cycling through the pre-autophagosomal structure and is necessary to promote ATG18 binding to ATG9 through phosphorylation of ATG9.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
ATG1 Protein, Candida glabrata, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Serine/threonine protein kinase involved in the cytoplasm to vacuole transport (Cvt) and found to be essential in autophagy, where it is required for the formation of autophagosomes. Involved in the clearance of protein aggregates which cannot be efficiently cleared by the proteasome. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Also involved in endoplasmic reticulum-specific autophagic process, in selective removal of ER-associated degradation (ERAD) substrates. Plays a key role in ATG9 and ATG23 cycling through the pre-autophagosomal structure and is necessary to promote ATG18 binding to ATG9 through phosphorylation of ATG9.
Species Candida glabrata
Expression System E. coli
Tag N-terminal 6xHis-tagged
Accession Number Q6FL58
Synonyms Autophagy-related protein 1, Serine/threonine-protein kinase ATG1, ATG1
Amino Acid YVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPILKIADFGFARFLPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGFEEFFNNKIV Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 11-312 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 38.4 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Serine/threonine protein kinase involved in the cytoplasm to vacuole transport (Cvt) and found to be essential in autophagy, where it is required for the formation of autophagosomes. Involved in the clearance of protein aggregates which cannot be efficiently cleared by the proteasome. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Also involved in endoplasmic reticulum-specific autophagic process, in selective removal of ER-associated degradation (ERAD) substrates. Plays a key role in ATG9 and ATG23 cycling through the pre-autophagosomal structure and is necessary to promote ATG18 binding to ATG9 through phosphorylation of ATG9.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

ATG1 Protein, Candida glabrata, Recombinant (His) Autophagy-related protein 1 Serine/threonine-protein kinase ATG1 ATG1 recombinant recombinant-proteins proteins protein

 

TargetMol