Shopping Cart
Remove All
Your shopping cart is currently empty
ATG1 Protein, Candida glabrata, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 38.4 kDa and the accession number is Q6FL58.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $543 | 20 days | 20 days | |
| 100 μg | $745 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | ATG1 Protein, Candida glabrata, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 38.4 kDa and the accession number is Q6FL58. |
| Species | Candida glabrata |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q6FL58 |
| Synonyms | Serine/threonine-protein kinase ATG1,Autophagy-related protein 1,ATG1 |
| Amino Acid | YVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPILKIADFGFARFLPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGFEEFFNNKIV |
| Construction | 11-312 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 38.4 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Serine/threonine protein kinase involved in the cytoplasm to vacuole transport (Cvt) and found to be essential in autophagy, where it is required for the formation of autophagosomes. Involved in the clearance of protein aggregates which cannot be efficiently cleared by the proteasome. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Also involved in endoplasmic reticulum-specific autophagic process, in selective removal of ER-associated degradation (ERAD) substrates. Plays a key role in ATG9 and ATG23 cycling through the pre-autophagosomal structure and is necessary to promote ATG18 binding to ATG9 through phosphorylation of ATG9. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.