Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

ATG1 Protein, Candida glabrata, Recombinant (His)

Catalog No. TMPH-00340

ATG1 Protein, Candida glabrata, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 38.4 kDa and the accession number is Q6FL58.

ATG1 Protein, Candida glabrata, Recombinant (His)

ATG1 Protein, Candida glabrata, Recombinant (His)

Catalog No. TMPH-00340
ATG1 Protein, Candida glabrata, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 38.4 kDa and the accession number is Q6FL58.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
ATG1 Protein, Candida glabrata, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 38.4 kDa and the accession number is Q6FL58.
Species
Candida glabrata
Expression System
E. coli
TagN-6xHis
Accession NumberQ6FL58
Synonyms
Serine/threonine-protein kinase ATG1,Autophagy-related protein 1,ATG1
Amino Acid
YVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPILKIADFGFARFLPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGFEEFFNNKIV
Construction
11-312 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight38.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Serine/threonine protein kinase involved in the cytoplasm to vacuole transport (Cvt) and found to be essential in autophagy, where it is required for the formation of autophagosomes. Involved in the clearance of protein aggregates which cannot be efficiently cleared by the proteasome. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Also involved in endoplasmic reticulum-specific autophagic process, in selective removal of ER-associated degradation (ERAD) substrates. Plays a key role in ATG9 and ATG23 cycling through the pre-autophagosomal structure and is necessary to promote ATG18 binding to ATG9 through phosphorylation of ATG9.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords