ATF-3 Protein, Human, Recombinant (His)

Name: ATF-3 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01164
Rating: 4.5 (1 reviews)

(Synonyms: Cyclic AMP-dependent transcription factor ATF-3, cAMP-dependent transcription factor ATF-3, ATF3, Activating transcription factor 3) Copy Product Info

Synonyms: Cyclic AMP-dependent transcription factor ATF-3, cAMP-dependent transcription factor ATF-3, ATF3, Activating transcription factor 3

Catalog No. TMPH-01164 Copy Product Info

ATF3 Protein, Human, Recombinant (His) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$89	20 days	20 days
10 µg	$143	20 days	20 days
20 µg	$237	20 days	20 days
50 µg	$358	20 days	20 days
100 µg	$490	20 days	20 days
200 µg	$755	20 days	20 days
500 µg	$1,330	20 days	20 days
1 mg	$2,080	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:85%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	ATF3 Protein, Human, Recombinant (His) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P18847
Amino Acid	MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Construction	1-181 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Cyclic AMP-dependent transcription factor ATF-3, cAMP-dependent transcription factor ATF-3, ATF3, Activating transcription factor 3
Research Background	This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGTActivates transcription presumably by sequestering inhibitory cofactors away from the promoters.

Chemical Properties

Molecular Weight

26.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.