Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

ARF1 Protein, Human, Recombinant

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04805

ARF1 Protein, Human, Recombinant is expressed in E. coli. The accession number is P84077.

ARF1 Protein, Human, Recombinant

ARF1 Protein, Human, Recombinant

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04805
ARF1 Protein, Human, Recombinant is expressed in E. coli. The accession number is P84077.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$13520 days20 days
10 μg$21620 days20 days
20 μg$34820 days20 days
50 μg$43320 days20 days
100 μg$52320 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
ARF1 Protein, Human, Recombinant is expressed in E. coli. The accession number is P84077.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP84077
Synonyms
ARF1,ARF 1,ADP-ribosylation factor 1
Amino Acid
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Construction
2-181 aa
Protein Purity
> 90% as determined by SDS-PAGE
Molecular Weight20.7 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.