ARF1 Protein, Human, Recombinant

Name: ARF1 Protein, Human, Recombinant
Brand: TargetMol
SKU: TMPH-04805
Rating: 4.5 (1 reviews)

(Synonyms: ARF1, ARF 1, ADP-ribosylation factor 1) Copy Product Info

Synonyms: ARF1, ARF 1, ADP-ribosylation factor 1

Catalog No. TMPH-04805 Copy Product Info

ARF1 Protein, Human, Recombinant is expressed in E. coli. The accession number is P84077.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$135	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$348	20 days	20 days
50 µg	$433	20 days	20 days
100 µg	$523	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	ARF1 Protein, Human, Recombinant is expressed in E. coli. The accession number is P84077.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	P84077
Amino Acid	GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Construction	2-181 aa
Protein Purity	> 90% as determined by SDS-PAGE
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	ARF1, ARF 1, ADP-ribosylation factor 1

Chemical Properties

Molecular Weight

20.7 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.