Aquaporin-1/AQP1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 198.00 | |
100 μg | 20 days | $ 389.00 | |
1 mg | 20 days | $ 1,680.00 |
Description | Aquaporin-1/AQP1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. |
Species | Human |
Expression System | E. coli |
Tag | N-terminal 6xHis-SUMO-tagged |
Accession Number | P29972 |
Synonyms | AQP1, AQP-1, Urine water channel, Aquaporin-1, Aquaporin-CHIP, CHIP28, Water channel protein for red blood cells and kidney proximal tubule |
Amino Acid | GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 220-269 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 21.6 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Aquaporin-1/AQP1 Protein, Human, Recombinant (His & SUMO) AQP1 AQP-1 Urine water channel Aquaporin-1 Aquaporin-CHIP CHIP28 Water channel protein for red blood cells and kidney proximal tubule recombinant recombinant-proteins proteins protein