Home Tools
Log in
Cart

APOB Protein, Human, Recombinant (Yeast, His)

Catalog No. TMPH-00945
Synonyms: Apolipoprotein B-100, Apo B-100, APOB

APOB Protein, Human, Recombinant (Yeast, His) is expressed in Yeast.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
APOB Protein, Human, Recombinant (Yeast, His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 231.00
100 μg 20 days $ 437.00
500 μg 20 days $ 1,210.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description APOB Protein, Human, Recombinant (Yeast, His) is expressed in Yeast.
Species Human
Expression System P. pastoris (Yeast)
Tag N-6xHis
Accession Number P04114
Synonyms Apolipoprotein B-100, Apo B-100, APOB
Amino Acid EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Construction 28-127 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 13.2 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

APOB Protein, Human, Recombinant (Yeast, His) Apolipoprotein B-100 Apo B-100 APOB recombinant recombinant-proteins proteins protein

 

TargetMol