APOA1 Protein, Bovine, Recombinant (His)

Name: APOA1 Protein, Bovine, Recombinant (His)
Brand: TargetMol
SKU: TMPH-00225
Rating: 4.5 (1 reviews)

(Synonyms: Apolipoprotein A-I, Apolipoprotein A1, ApoA-I, Apo-AI, APOA1) Copy Product Info

Synonyms: Apolipoprotein A-I, Apolipoprotein A1, ApoA-I, Apo-AI, APOA1

Catalog No. TMPH-00225 Copy Product Info

Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. APOA1 Protein, Bovine, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.5 kDa and the accession number is P15497.

APOA1 Protein, Bovine, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 µg	$143	20 days	20 days
10 µg	$238	20 days	20 days
20 µg	$397	20 days	20 days
50 µg	$597	20 days	20 days
100 µg	$845	20 days	20 days
200 µg	$1,190	20 days	20 days
500 µg	$1,950	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. APOA1 Protein, Bovine, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.5 kDa and the accession number is P15497.
Species	Bovine
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P15497
Amino Acid	DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
Construction	25-265 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Apolipoprotein A-I, Apolipoprotein A1, ApoA-I, Apo-AI, APOA1
Research Background	Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.

Chemical Properties

Molecular Weight

29.5 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.