Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Androgen receptor Protein, Human, Recombinant (His & Myc & SUMO)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00932 Copy Product Info
Androgen receptor Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli.

Androgen receptor Protein, Human, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-00932
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Androgen receptor Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli.

Androgen receptor Protein, Human, Recombinant (His & Myc & SUMO)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$75-In Stock
10 μg$119-In Stock
20 μg$198-In Stock
50 μg$29720 days20 days
100 μg$42720 days20 days
200 μg$65820 days20 days
500 μg$1,17020 days20 days
1 mg$1,83020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Androgen receptor Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli.
Species
Human
Expression System
E. coli
TagN-10xHis-SUMO, C-Myc
Accession NumberP10275
Synonyms
Nuclear receptor subfamily 3 group C member 4,NR3C4,Dihydrotestosterone receptor,DHTR,AR,Androgen receptor
Amino Acid
DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT
Construction
551-919 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Androgen receptor Protein, Human, Recombinant (His & Myc & SUMO)
Molecular Weight62.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins like ZBTB7A that recruits NCOR1 and NCOR2 to the androgen response elements/ARE on target genes, negatively regulating androgen receptor signaling and androgen-induced cell proliferation. Transcription activation is also down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3.; Lacks the C-terminal ligand-binding domain and may therefore constitutively activate the transcription of a specific set of genes independently of steroid hormones.; Lacks the C-terminal ligand-binding domain and may therefore constitutively activate the transcription of a specific set of genes independently of steroid hormones.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords