Home Tools
Log in
Cart

ANAPC15 Protein, Human, Recombinant (GST)

Catalog No. TMPH-00931
Synonyms: Anaphase-promoting complex subunit 15, APC15

ANAPC15 Protein, Human, Recombinant (GST) is expressed in E. coli.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
ANAPC15 Protein, Human, Recombinant (GST)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 198.00
100 μg 20 days $ 389.00
1 mg 20 days $ 1,680.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description ANAPC15 Protein, Human, Recombinant (GST) is expressed in E. coli.
Species Human
Expression System E. coli
Tag N-terminal GST-tagged
Accession Number P60006
Synonyms Anaphase-promoting complex subunit 15, APC15
Amino Acid MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-121 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 41.3 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating in the responsiveness of the spindle assembly checkpoint. Also required for degradation of CDC20.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

ANAPC15 Protein, Human, Recombinant (GST) Anaphase-promoting complex subunit 15 APC15 recombinant recombinant-proteins proteins protein

 

TargetMol