Shopping Cart
- Remove All
- Your shopping cart is currently empty
Alr2278 Protein, Nostoc sp., Recombinant (His & MBP) is expressed in Baculovirus.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $176 | 20 days | |
10 μg | $293 | 20 days | |
20 μg | $491 | 20 days | |
50 μg | $926 | 20 days | |
100 μg | $1,500 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Alr2278 Protein, Nostoc sp., Recombinant (His & MBP) is expressed in Baculovirus. |
Species | Nostoc |
Expression System | Baculovirus Insect Cells |
Tag | N-MBP, C-6xHis |
Accession Number | Q8YUQ7 |
Amino Acid | MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAFECQHTSSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIKYEDSNLYDD |
Construction | 1-189 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 65.2 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | N/A |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.