Shopping Cart
- Remove All
Your shopping cart is currently empty
Alr2278 Protein, Nostoc sp., Recombinant (His & MBP)
Catalog No. TMPH-03065
Alr2278 Protein, Nostoc sp., Recombinant (His & MBP) is expressed in Baculovirus.
Alr2278 Protein, Nostoc sp., Recombinant (His & MBP)
Catalog No. TMPH-03065
Alr2278 Protein, Nostoc sp., Recombinant (His & MBP) is expressed in Baculovirus.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $176 | 20 days | |
| 10 μg | $293 | 20 days | |
| 20 μg | $491 | 20 days | |
| 50 μg | $926 | 20 days | |
| 100 μg | $1,500 | 20 days |
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Alr2278 Protein, Nostoc sp., Recombinant (His & MBP) is expressed in Baculovirus. |
| Species | Nostoc |
| Expression System | Baculovirus Insect Cells |
| Tag | N-MBP, C-6xHis |
| Accession Number | Q8YUQ7 |
| Amino Acid | MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAFECQHTSSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIKYEDSNLYDD |
| Construction | 1-189 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 65.2 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | N/A |
Dose Conversion
You can also refer to dose conversion for different animals. More
Sci Citations
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.