Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Alr2278 Protein, Nostoc sp., Recombinant (His & MBP)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03065

Alr2278 Protein, Nostoc sp., Recombinant (His & MBP) is expressed in Baculovirus.

Alr2278 Protein, Nostoc sp., Recombinant (His & MBP)

Alr2278 Protein, Nostoc sp., Recombinant (His & MBP)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03065
Alr2278 Protein, Nostoc sp., Recombinant (His & MBP) is expressed in Baculovirus.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$17620 days20 days
10 μg$29320 days20 days
20 μg$49120 days20 days
50 μg$92620 days20 days
100 μg$1,50020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Alr2278 Protein, Nostoc sp., Recombinant (His & MBP) is expressed in Baculovirus.
Species
Nostoc
Expression System
Baculovirus Insect Cells
TagN-MBP, C-6xHis
Accession NumberQ8YUQ7
Amino Acid
MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAFECQHTSSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIKYEDSNLYDD
Construction
1-189 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight65.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.