Alpha-hemolysin Protein, S. aureus, Recombinant

Catalog No. TMPH-04388 Copy Product Info

Alpha-hemolysin Protein, S. aureus, Recombinant is expressed in Yeast. The accession number is P09616.

Alpha-hemolysin Protein, S. aureus, Recombinant

Catalog No. TMPH-04388

Copy Product Info

Alpha-hemolysin Protein, S. aureus, Recombinant is expressed in Yeast. The accession number is P09616.

Pack Size	Price	USA Stock	Global Stock
5 μg	$222	-	In Stock
10 μg	$369	-	In Stock
20 μg	$623	-	In Stock
50 μg	$792	20 days	20 days
100 μg	$987	-	In Stock
200 μg	$1,380	20 days	20 days
500 μg	$2,250	20 days	20 days
1 mg	$3,230	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Alpha-hemolysin Protein, S. aureus, Recombinant is expressed in Yeast. The accession number is P09616.
Species	Staphylococcus aureus
Expression System	P. pastoris (Yeast)
Tag	Tag Free
Accession Number	P09616
Synonyms	hly,hla,Alpha-toxin,Alpha-HL,Alpha-hemolysin
Amino Acid	ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Construction	27-319 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	34.0 kDa (Predicted)
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 25 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.