Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: hly, hla, Alpha-toxin, Alpha-HL, Alpha-hemolysin


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $222 | - | In Stock | |
| 10 μg | $369 | - | In Stock | |
| 20 μg | $623 | - | In Stock | |
| 50 μg | $792 | 20 days | 20 days | |
| 100 μg | $987 | - | In Stock | |
| 200 μg | $1,380 | 20 days | 20 days | |
| 500 μg | $2,250 | 20 days | 20 days | |
| 1 mg | $3,230 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Alpha-hemolysin Protein, S. aureus, Recombinant is expressed in Yeast. The accession number is P09616. |
| Species | Staphylococcus aureus |
| Expression System | P. pastoris (Yeast) |
| Tag | Tag Free |
| Accession Number | P09616 |
| Amino Acid | ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN |
| Construction | 27-319 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. ![]() |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 25 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | hly, hla, Alpha-toxin, Alpha-HL, Alpha-hemolysin |
| Molecular Weight | 34.0 kDa (Predicted) |
| Storage | Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.