Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K(+) efflux and Ca(2+) uptake.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K(+) efflux and Ca(2+) uptake. |
Species | Raphanus sativus |
Expression System | E. coli |
Tag | N-terminal 6xHis-SUMO-tagged |
Accession Number | P30230 |
Synonyms | Cysteine-rich antifungal protein 2, Defensin-like protein 2, RAFP2 |
Amino Acid | QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 30-80 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 21.7 kDa as predicted |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K(+) efflux and Ca(2+) uptake. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
AFP2 Protein, Raphanus sativus, Recombinant (His & SUMO) Cysteine-rich antifungal protein 2 Defensin-like protein 2 RAFP2 recombinant recombinant-proteins proteins protein