Home Tools
Log in
Cart

AaH II Protein, Androctonus australis, Recombinant (His & SUMO)

Catalog No. TMPH-00054
Synonyms: Toxin II, Neurotoxin II, AaHII, Alpha-mammal toxin AaH2

Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The toxin principally slows the inactivation process of TTX-sensitive sodium channels. It is active on rat brain Nav1.2/SCN2A sodium channel (EC(50)=2.6 nM) and on rat skeletal muscle Nav1.4/SCN4A sodium channel (EC(50)=2.2 nM), as well as on human neuronal Nav1.7/SCN9A (EC(50)=6.8 nM). This toxin is active against mammals. In vivo, intraplantar injection into mice induces spontaneous pain responses.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
AaH II Protein, Androctonus australis, Recombinant (His & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The toxin principally slows the inactivation process of TTX-sensitive sodium channels. It is active on rat brain Nav1.2/SCN2A sodium channel (EC(50)=2.6 nM) and on rat skeletal muscle Nav1.4/SCN4A sodium channel (EC(50)=2.2 nM), as well as on human neuronal Nav1.7/SCN9A (EC(50)=6.8 nM). This toxin is active against mammals. In vivo, intraplantar injection into mice induces spontaneous pain responses.
Species Androctonus australis
Expression System E. coli
Tag N-terminal 6xHis-SUMO-tagged
Accession Number P01484
Synonyms Toxin II, Neurotoxin II, AaHII, Alpha-mammal toxin AaH2
Amino Acid VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 20-83 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 23.3 kDa (predicted)
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The toxin principally slows the inactivation process of TTX-sensitive sodium channels. It is active on rat brain Nav1.2/SCN2A sodium channel (EC(50)=2.6 nM) and on rat skeletal muscle Nav1.4/SCN4A sodium channel (EC(50)=2.2 nM), as well as on human neuronal Nav1.7/SCN9A (EC(50)=6.8 nM). This toxin is active against mammals. In vivo, intraplantar injection into mice induces spontaneous pain responses.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

AaH II Protein, Androctonus australis, Recombinant (His & SUMO) Toxin II Neurotoxin II AaHII Alpha-mammal toxin AaH2 recombinant recombinant-proteins proteins protein

 

TargetMol