Home Tools
Log in
Cart

2S albumin Protein, Glycine max, Recombinant (His & SUMO)

Catalog No. TMPH-00769
Synonyms: 2S seed storage albumin protein, Napin-type 2S albumin 3, 2S albumin, GM2S-1

This is a 2S seed storage protein.; binds to mammalian chromatin, preventing the normal formation of the kinetochore complex in the centromere and leading to the disruption of mitosis. 2S albumin Protein, Glycine max, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 32.2 kDa and the accession number is P19594.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
2S albumin Protein, Glycine max, Recombinant (His & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description This is a 2S seed storage protein.; binds to mammalian chromatin, preventing the normal formation of the kinetochore complex in the centromere and leading to the disruption of mitosis. 2S albumin Protein, Glycine max, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 32.2 kDa and the accession number is P19594.
Species Glycine max
Expression System E. coli
Tag N-6xHis-SUMO
Accession Number P19594
Synonyms 2S seed storage albumin protein, Napin-type 2S albumin 3, 2S albumin, GM2S-1
Amino Acid SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD
Construction 22-158 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 32.2 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background This is a 2S seed storage protein.; binds to mammalian chromatin, preventing the normal formation of the kinetochore complex in the centromere and leading to the disruption of mitosis.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

2S albumin Protein, Glycine max, Recombinant (His & SUMO) 2S seed storage albumin protein Napin-type 2S albumin 3 2S albumin GM2S-1 recombinant recombinant-proteins proteins protein

 

TargetMol