Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

14-3-3 zeta/delta Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03772 Copy Product Info
14-3-3 zeta/delta Protein, Human, Recombinant (His) is expressed in yeast. The accession number is P63104.

14-3-3 zeta/delta Protein, Human, Recombinant (His)

Catalog No. TMPH-03772
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

14-3-3 zeta/delta Protein, Human, Recombinant (His) is expressed in yeast. The accession number is P63104.

14-3-3 zeta/delta Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12520 days20 days
10 μg$19820 days20 days
20 μg$34320 days20 days
50 μg$51320 days20 days
100 μg$69620 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
14-3-3 zeta/delta Protein, Human, Recombinant (His) is expressed in yeast. The accession number is P63104.
Species
Human
Expression System
P. pastoris (Yeast)
TagC-6xHis
Accession NumberP63104
Synonyms
YWHAZ,Protein kinase C inhibitor protein 1 (KCIP-1),14-3-3 protein zeta/delta
Amino Acid
AEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Construction
1-245 aa
Protein Purity
> 90% as determined by SDS-PAGE.
14-3-3 zeta/delta Protein, Human, Recombinant (His)
Molecular Weight20.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation. In neurons, regulates spine maturation through the modulation of ARHGEF7 activity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords