Shopping Cart
Remove All
Your shopping cart is currently empty
Tat-M2NX, a peptide antagonist of transient receptor potential melastatin 2 (TRPM2), blocks hydrogen peroxide-induced calcium influx in HEK293 cells expressing human TRPM2 at concentrations between 25 to 100 µM. In male mice models of stroke caused by middle cerebral artery occlusion (MCAO), Tat-M2NX (20 mg/kg) demonstrates efficacy in reducing brain infarct volume when applied before or 3 hours-post occlusion, yet it shows no such effect in female mice.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $141 | 7-10 days | 7-10 days | |
| 5 mg | $628 | 7-10 days | 7-10 days | |
| 10 mg | $987 | 7-10 days | 7-10 days |
| Description | Tat-M2NX, a peptide antagonist of transient receptor potential melastatin 2 (TRPM2), blocks hydrogen peroxide-induced calcium influx in HEK293 cells expressing human TRPM2 at concentrations between 25 to 100 µM. In male mice models of stroke caused by middle cerebral artery occlusion (MCAO), Tat-M2NX (20 mg/kg) demonstrates efficacy in reducing brain infarct volume when applied before or 3 hours-post occlusion, yet it shows no such effect in female mice. |
| Molecular Weight | 4354.20 |
| Formula | C190H323N71O45S.XCF3COOH |
| Sequence | H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val-OH |
| Sequence Short | YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.