Your shopping cart is currently empty

Tat-M2NX, a peptide antagonist of transient receptor potential melastatin 2 (TRPM2), blocks hydrogen peroxide-induced calcium influx in HEK293 cells expressing human TRPM2 at concentrations between 25 to 100 µM. In male mice models of stroke caused by middle cerebral artery occlusion (MCAO), Tat-M2NX (20 mg/kg) demonstrates efficacy in reducing brain infarct volume when applied before or 3 hours-post occlusion, yet it shows no such effect in female mice.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $141 | 7-10 days | 7-10 days | |
| 5 mg | $628 | 7-10 days | 7-10 days | |
| 10 mg | $987 | 7-10 days | 7-10 days |
| Description | Tat-M2NX, a peptide antagonist of transient receptor potential melastatin 2 (TRPM2), blocks hydrogen peroxide-induced calcium influx in HEK293 cells expressing human TRPM2 at concentrations between 25 to 100 µM. In male mice models of stroke caused by middle cerebral artery occlusion (MCAO), Tat-M2NX (20 mg/kg) demonstrates efficacy in reducing brain infarct volume when applied before or 3 hours-post occlusion, yet it shows no such effect in female mice. |
| Molecular Weight | 4354.20 |
| Formula | C190H323N71O45S.XCF3COOH |
| Smiles | OC(C(F)(F)F)=O.O=C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN[H])C(N[C@@H](CCCCN[H])C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(O)=O)C(N1CCC[C@H]1C(NCC(N[C@@H](CCC(O)=O)C(N[C@@H](CCSC)C(N[C@H](C(N2CCC[C@H]2C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN[H])C(N[C@H](C(N[C@@H](CCCCN[H])C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C(C)C)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@@H](CC3=CNC4=C3C=CC=C4)C(N[C@@H](C(C)C)C(O)=O)=O)=O)CC5=CC=CC=C5)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC6=CC=C(O)C=C6)N[H] |
| Sequence | H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val-OH |
| Sequence Short | YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.