Shopping Cart
Remove All
Your shopping cart is currently empty
Somatorelin (1-44) amide is a synthetic peptide that corresponds to the full 44-amino acid sequence of growth hormone-releasing hormone (GHRH), a hormone that stimulates the production of growth hormone from the pituitary gland and is involved in the regulation of cell proliferation and differentiation.1,2Somatorelin induces growth hormone release similarly to GHRHin vitroandin vivo.1
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 500 μg | $858 | 35 days | 35 days | |
| 1 mg | $1,650 | 35 days | 35 days |
| Description | Somatorelin (1-44) amide is a synthetic peptide that corresponds to the full 44-amino acid sequence of growth hormone-releasing hormone (GHRH), a hormone that stimulates the production of growth hormone from the pituitary gland and is involved in the regulation of cell proliferation and differentiation.1,2Somatorelin induces growth hormone release similarly to GHRHin vitroandin vivo.1 |
| Relative Density. | no data available |
| Sequence | H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 |
| Sequence Short | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 10 mg/mL, Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.