Your shopping cart is currently empty

Somatorelin (1-44) amide is a synthetic peptide that corresponds to the full 44-amino acid sequence of growth hormone-releasing hormone (GHRH), a hormone that stimulates the production of growth hormone from the pituitary gland and is involved in the regulation of cell proliferation and differentiation.1,2Somatorelin induces growth hormone release similarly to GHRHin vitroandin vivo.1
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 500 μg | $858 | 35 days | 35 days | |
| 1 mg | $1,650 | 35 days | 35 days |
| Description | Somatorelin (1-44) amide is a synthetic peptide that corresponds to the full 44-amino acid sequence of growth hormone-releasing hormone (GHRH), a hormone that stimulates the production of growth hormone from the pituitary gland and is involved in the regulation of cell proliferation and differentiation.1,2Somatorelin induces growth hormone release similarly to GHRHin vitroandin vivo.1 |
| Relative Density. | no data available |
| Sequence | H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 |
| Sequence Short | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 10 mg/mL, Sonication is recommended. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.