Your shopping cart is currently empty

RG33, a synthetic 33-amino acid peptide, matches the sequence of amino acids 209-219 and 220-241 found in the C-terminal domain class Y helices of apolipoprotein A1 (ApoA1). This compound has the ability to solubilize multilamellar vesicles (MLVs) containing 1,2-dimyristoyl-sn-glycero-3-PC (DMPC), resulting in the formation of recombinant HDL. When bound to lipids, RG33 facilitates cholesterol efflux in J774 macrophages and has been shown to reduce blood glucose levels in insulin-resistant mice at a dosage of 12 mg/kg.


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 500 μg | $76 | Inquiry | Inquiry | |
| 1 mg | $137 | Inquiry | Inquiry | |
| 5 mg | $588 | Inquiry | Inquiry | |
| 10 mg | $1,050 | Inquiry | Inquiry |
| Description | RG33, a synthetic 33-amino acid peptide, matches the sequence of amino acids 209-219 and 220-241 found in the C-terminal domain class Y helices of apolipoprotein A1 (ApoA1). This compound has the ability to solubilize multilamellar vesicles (MLVs) containing 1,2-dimyristoyl-sn-glycero-3-PC (DMPC), resulting in the formation of recombinant HDL. When bound to lipids, RG33 facilitates cholesterol efflux in J774 macrophages and has been shown to reduce blood glucose levels in insulin-resistant mice at a dosage of 12 mg/kg. |
| Molecular Weight | 3790.36 |
| Formula | C175H282N42O51.XCF3COOH |
| Smiles | NC([C@H](CC(N)=O)NC([C@H](CC(C)C)NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@@]([C@@H](C)O)([H])NC([C@@H](NC([C@H](CCC(O)=O)NC([C@H](CCC(O)=O)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](CO)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](CO)NC([C@H](C(C)C)NC([C@H](CCCCN)NC([C@@H](NC([C@H](CO)NC([C@H](CCC(O)=O)NC([C@H](CC(C)C)NC([C@H](C(C)C)NC([C@@H]1CCCN1C([C@H](CC(C)C)NC([C@H](CC(C)C)NC(CNC([C@H](CCC(N)=O)NC([C@H](CCCNC(N)=N)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](CCC(O)=O)NC([C@H](CC(C)C)NC([C@@H](NC([C@@H]2CCCN2C(C)=O)=O)C)=O)=O)=O)CC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC3=CC=CC=C3)=O)=O)=O)=O)CC4=CC=CC=C4)=O)=O)=O)C)=O)=O)=O)=O)CC5=CC=C(O)C=C5)=O)=O)=O)=O)=O)=O.OC(C(F)(F)F)=O |
| Sequence | Ac-Pro-Ala-Leu-Glu-Asp-Leu-Arg-Gln-Gly-Leu-Leu-Pro-Val-Leu-Glu-Ser-Phe-Lys-Val-Ser-Phe-Leu-Ser-Ala-Leu-Glu-Glu-Tyr-Thr-Lys-Lys-Leu-Asn-NH2 |
| Sequence Short | PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.