Shopping Cart
- Remove All
- Your shopping cart is currently empty
PTH (2-38) (human) plays a role in bone anabolism and can elevate serum levels of INS-PTH (complete N-terminal specific PTH) [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | PTH (2-38) (human) plays a role in bone anabolism and can elevate serum levels of INS-PTH (complete N-terminal specific PTH) [1]. |
Cas No. | 154765-04-5 |
Sequence | Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly |
Sequence Short | VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.