Shopping Cart
- Remove All
- Your shopping cart is currently empty
Peptide B, Bovine, an immunoregulatory peptide derived from αs1-casein B-8P (f1-13) in bovine milk, is predominantly generated during maturation and exhibits antihypertensive effects [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Peptide B, Bovine, an immunoregulatory peptide derived from αs1-casein B-8P (f1-13) in bovine milk, is predominantly generated during maturation and exhibits antihypertensive effects [1] [2]. |
Cas No. | 87713-86-8 |
Sequence Short | FAEPLPSEEEGESYSKEVPEMEKRYGGFMRF |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.