Shopping Cart
- Remove All
- Your shopping cart is currently empty
Myristoyl-(Lys12,27,28)-VIP-Gly-Gly-Thr (free acid) acts as a selective and potent antagonist of the VPAC2 receptor [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $263 | 7-10 days | |
5 mg | $435 | 7-10 days | |
10 mg | $652 | 7-10 days | |
25 mg | $1,108 | 7-10 days | |
50 mg | $1,662 | 7-10 days | |
100 mg | $2,490 | 7-10 days |
Description | Myristoyl-(Lys12,27,28)-VIP-Gly-Gly-Thr (free acid) acts as a selective and potent antagonist of the VPAC2 receptor [1]. |
Cas No. | 2243219-86-3 |
Sequence | {Myr}-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Lys-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Lys-Lys-Gly-Gly-Thr |
Sequence Short | {Myr}-HSDAVFTDNYTKLRKQMAVKKYLNSIKKGGT |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.