Shopping Cart
- Remove All
- Your shopping cart is currently empty
Latartoxin-1a (LtTx-1a), a paralytic and lethal peptide toxin for insects with membrane-bound activity [1], can be isolated from L. tarabaevi.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Latartoxin-1a (LtTx-1a), a paralytic and lethal peptide toxin for insects with membrane-bound activity [1], can be isolated from L. tarabaevi. |
Synonyms | LtTx-1a |
Sequence | Glu-Cys-Ile-Pro-Thr-Lys-His-Asp-Cys-Thr-Asn-Asp-Arg-Lys-Asn-Cys-Cys-Pro-Gly-His-Glu-Cys-Lys-Cys-Tyr-Asn-Thr-Gln-Ile-Gly-Gly-Ser-Lys-Lys-Glu-Gln-Cys-Gly-Cys-Lys-Lys-Ser-Leu-Leu-Ala-Lys-Ala-Lys-Asn-Phe-Gly-Gly-Lys-Val-Ile-Thr-Ile-Phe-Lys-Ala (Disulfide brid |
Sequence Short | ECIPTKHDCTNDRKNCCPGHECKCYNTQIGGSKKEQCGCKKSLLAKAKNFGGKVITIFKA (Disulfide bridge: Cys2-Cys17; Cys9-Cys22; Cys16-Cys39; Cys24-Cys37) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.