Shopping Cart
- Remove All
- Your shopping cart is currently empty
Human GIP(3-30), amide, is a high-affinity antagonist of the human GIP receptor in vitro [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Inquiry | |
50 mg | Inquiry | Inquiry |
Description | Human GIP(3-30), amide, is a high-affinity antagonist of the human GIP receptor in vitro [1]. |
Molecular Weight | 3297.69 |
Formula | C150H226N38O44S |
Cas No. | 1884226-05-4 |
Sequence | Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 |
Sequence Short | EGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2 |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.