Shopping Cart
- Remove All
- Your shopping cart is currently empty
GLP-2 (1-34) (human), a polypeptide secreted from the intestine shortly after eating, is used in research related to bone remodeling processes [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | GLP-2 (1-34) (human), a polypeptide secreted from the intestine shortly after eating, is used in research related to bone remodeling processes [1]. |
Cas No. | 99120-49-7 |
Sequence | His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg |
Sequence Short | HADGSFSDEMNTILDNLAARDFINWLIQTKITDR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.