Your shopping cart is currently empty

Galanin (Human) (Acetate) is a 30-amino acid neuropeptide and galanin (GAL) receptor agonist.It inhibits forskolin-induced cAMP production in HEK293E cells expressing recombinant human GAL1 receptors (EC50= 0.031 nM) and stimulates inositol phosphate accumulation in CHO cells expressing recombinant human GAL2receptors (EC50= 12.3 nM).Human galanin induces contractions in isolated rat longitudinal fundus strips with an EC50value of 13.8 nM.Intrathecal administration of human galanin (3, 10, and 30 nmol/animal) reduces paw licking and flinching in the second, but not first, phase of the formalin test in rats.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $379 | Inquiry | Inquiry |
| Description | Galanin (Human) (Acetate) is a 30-amino acid neuropeptide and galanin (GAL) receptor agonist.It inhibits forskolin-induced cAMP production in HEK293E cells expressing recombinant human GAL1 receptors (EC50= 0.031 nM) and stimulates inositol phosphate accumulation in CHO cells expressing recombinant human GAL2receptors (EC50= 12.3 nM).Human galanin induces contractions in isolated rat longitudinal fundus strips with an EC50value of 13.8 nM.Intrathecal administration of human galanin (3, 10, and 30 nmol/animal) reduces paw licking and flinching in the second, but not first, phase of the formalin test in rats. |
| Relative Density. | no data available |
| Sequence | H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH. |
| Sequence Short | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 1 mg/mL, Sonication is recommended. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.