CCL4 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02567 Copy Product Info

Monokine with inflammatory and chemokinetic properties.

CCL4 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02567

Copy Product Info

Monokine with inflammatory and chemokinetic properties.

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	-	In Stock
10 μg	$169	20 days	20 days
20 μg	$283	-	In Stock
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Monokine with inflammatory and chemokinetic properties.
Species	Mouse
Expression System	E. coli
Tag	N-6xHis
Accession Number	P14097
Synonyms	Small-inducible cytokine A4,SIS-gamma,Scya4,Protein H400,Mip1b,Macrophage inflammatory protein 1-beta (MIP-1-beta),Immune activation protein 2 (ACT-2;ACT2),Ccl4,C-C motif chemokine 4
Amino Acid	APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Construction	24-92 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	11.8 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Monokine with inflammatory and chemokinetic properties.