Shopping Cart
- Remove All
- Your shopping cart is currently empty
Angiopep-Bim BH3 hydrochloride, a peptode that penetrates the blood-brain barrier (BBB), may serve as a tool to study the permeability of central nervous system (CNS) therapeutics [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Angiopep-Bim BH3 hydrochloride, a peptode that penetrates the blood-brain barrier (BBB), may serve as a tool to study the permeability of central nervous system (CNS) therapeutics [1]. |
Sequence Short | TFFYGGSRGKRNNFKTEEYLPSTGGGGGDMRPEIWIAQELRRIGDEFNAYYARR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.