Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His)

Name: Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His)
Brand: TargetMol
SKU: TMPH-03727
Rating: 4.5 (1 reviews)

(Synonyms: VP40, Membrane-associated protein VP40, Matrix protein VP40, Ebola VP40 (eVP40)) Copy Product Info

Synonyms: VP40, Membrane-associated protein VP40, Matrix protein VP40, Ebola VP40 (eVP40)

Catalog No. TMPH-03727 Copy Product Info

Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 39.3 kDa and the accession number is Q77DJ6.

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 39.3 kDa and the accession number is Q77DJ6.
Species	ZEBOV
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q77DJ6
Amino Acid	MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
Construction	1-326 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	VP40, Membrane-associated protein VP40, Matrix protein VP40, Ebola VP40 (eVP40)
Research Background	Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT (endosomal sorting complex required for transport) system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. The interaction with host E3 ubiquitin ligase SMURF2 also facilitates virus budding. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells (via RNAi suppression and exosome-bystander apoptosis).

Chemical Properties

Molecular Weight

39.3 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

VP 40Matrix protein VP-40Ebola VP-40 (eVP-40)

Related Tags: Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) chemical structure | Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) molecular weight