Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His)

Catalog No. TMPH-03727

Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 39.3 kDa and the accession number is Q77DJ6.

Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His)

Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His)

Catalog No. TMPH-03727
Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 39.3 kDa and the accession number is Q77DJ6.
Pack SizePriceAvailabilityQuantity
20 μg $36020 days
100 μg $74520 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 39.3 kDa and the accession number is Q77DJ6.
Species
ZEBOV
Expression System
E. coli
TagN-6xHis
Accession NumberQ77DJ6
Synonyms
VP40,Membrane-associated protein VP40,Matrix protein VP40,Ebola VP40 (eVP40)
Amino Acid
MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
Construction
1-326 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight39.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT (endosomal sorting complex required for transport) system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. The interaction with host E3 ubiquitin ligase SMURF2 also facilitates virus budding. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells (via RNAi suppression and exosome-bystander apoptosis).

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords