Shopping Cart

Your shopping cart is currently empty

TRPA1 Protein, Rat, Recombinant (His & Myc)

Name: TRPA1 Protein, Rat, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-03389
Rating: 4.5 (1 reviews)

(Synonyms: Wasabi receptor, Trpa1, Transient receptor potential cation channel subfamily A member 1, Ankyrin-like with transmembrane domains protein 1, Anktm1) Copy Product Info

Synonyms: Wasabi receptor, Trpa1, Transient receptor potential cation channel subfamily A member 1, Ankyrin-like with transmembrane domains protein 1, Anktm1

Catalog No. TMPH-03389 Copy Product Info

TRPA1 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 27.3 kDa and the accession number is Q6RI86.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	In Stock	In Stock
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:85%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	TRPA1 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 27.3 kDa and the accession number is Q6RI86.
Species	Rat
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	Q6RI86
Amino Acid	IGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPFWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLSMQETRQEAPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDNHCSFQDRFKKERLEQMHSKWNFVLNAVKTKTHCSISHPDI
Construction	960-1125 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Wasabi receptor, Trpa1, Transient receptor potential cation channel subfamily A member 1, Ankyrin-like with transmembrane domains protein 1, Anktm1
Research Background

Chemical Properties

Molecular Weight

27.3 kDa (predicted)

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Trpa 1Anktm 1

Related Tags: TRPA1 Protein, Rat, Recombinant (His & Myc) chemical structure | TRPA1 Protein, Rat, Recombinant (His & Myc) molecular weight