Shopping Cart
Remove All
Your shopping cart is currently empty
TPSB2 Protein, Human, Recombinant (His & Myc)
(Synonyms: Tryptase-2, Tryptase II, Tryptase beta-2, TPSB2, TPS2) Copy Product InfoSynonyms: Tryptase-2, Tryptase II, Tryptase beta-2, TPSB2, TPS2
Catalog No. TMPH-02257 Copy Product Info
Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity. TPSB2 Protein, Human, Recombinant (His & Myc) is expressed in yeast with C-6xHis-Myc tag. The predicted molecular weight is 31.2 kDa and the accession number is P20231.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $86 | 20 days | 20 days | |
| 10 μg | $138 | 20 days | 20 days | |
| 20 μg | $231 | 20 days | 20 days | |
| 50 μg | $348 | 20 days | 20 days | |
| 100 μg | $480 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity. TPSB2 Protein, Human, Recombinant (His & Myc) is expressed in yeast with C-6xHis-Myc tag. The predicted molecular weight is 31.2 kDa and the accession number is P20231. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | C-6xHis-Myc |
| Accession Number | P20231 |
| Amino Acid | IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP |
| Construction | 31-275 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Tryptase-2, Tryptase II, Tryptase beta-2, TPSB2, TPS2 |
| Research Background |
| Molecular Weight | 31.2 kDa (predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Keywords
Preview
Related Tags: TPSB2 Protein, Human, Recombinant (His & Myc) chemical structure | TPSB2 Protein, Human, Recombinant (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.