Shopping Cart
Remove All
Your shopping cart is currently empty
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $50 | 20 days | 20 days | |
| 10 μg | $79 | 20 days | 20 days | |
| 20 μg | $127 | 20 days | 20 days | |
| 50 μg | $225 | 20 days | 20 days | |
| 100 μg | $350 | 20 days | 20 days | |
| 200 μg | $613 | 20 days | 20 days | |
| 500 μg | $1,290 | 20 days | 20 days | |
| 1 mg | $2,290 | 20 days | 20 days |
| Biological Activity | 1. Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/mL can bind human TNFRSF1B, the EC 50 is 1.632-2.699 ng/mL. 2. Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/mL can bind human TNFR1, the EC 50 of human LTA protein is 4.409-6.797 ng/mL. |
| Description | Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | N-6xHis |
| Accession Number | P01374 |
| Synonyms | Tumor necrosis factor ligand superfamily member 1,TNFSF1,TNF-beta,TNFB,Lymphotoxin-alpha,LT-alpha,LTA |
| Amino Acid | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Construction | 35-205 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Molecular Weight | 20.8 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.