TMPRSS2 Protein, Human, Recombinant (Cell-Free, His)

Name: TMPRSS2 Protein, Human, Recombinant (Cell-Free, His)
Brand: TargetMol
SKU: TMPH-02235
Rating: 4.5 (1 reviews)

(Synonyms: Transmembrane protease serine 2, TMPRSS2, Serine protease 10, PRSS10) Copy Product Info

Synonyms: Transmembrane protease serine 2, TMPRSS2, Serine protease 10, PRSS10

Catalog No. TMPH-02235 Copy Product Info

TMPRSS2 Protein, Human, Recombinant (Cell-Free, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 46.9 kDa and the accession number is O15393.

Pack Size	Price	USA Stock	Global Stock
5 μg	$289	20 days	20 days
10 μg	$485	20 days	20 days
20 μg	$817	20 days	20 days
50 μg	$1,130	20 days	20 days
100 μg	$1,450	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	TMPRSS2 Protein, Human, Recombinant (Cell-Free, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 46.9 kDa and the accession number is O15393.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	O15393
Amino Acid	WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Construction	106-492 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Transmembrane protease serine 2, TMPRSS2, Serine protease 10, PRSS10
Research Background

Chemical Properties

Molecular Weight

46.9 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

TMPRSS 2Serine protease10PRSS 10

Related Tags: TMPRSS2 Protein, Human, Recombinant (Cell-Free, His) chemical structure | TMPRSS2 Protein, Human, Recombinant (Cell-Free, His) molecular weight