Shopping Cart
- Remove All
- Your shopping cart is currently empty
Tissue Factor Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is P13726.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $100 | 20 days | |
10 μg | $162 | 20 days | |
20 μg | $269 | 20 days | |
50 μg | $353 | 20 days | |
100 μg | $437 | 20 days | |
200 μg | $798 | 20 days | |
500 μg | $1,780 | 20 days | |
1 mg | $3,280 | 20 days |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human TF at 2 μg/mL can bind Anti-TF recombinant antibody (CSB-RA007928MA2HU). The EC50 is 1.434-1.635 ng/mL. |
Description | Tissue Factor Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is P13726. |
Species | Human |
Expression System | HEK293 Cells |
Tag | C-10xHis |
Accession Number | P13726 |
Synonyms | Tissue factor,Thromboplastin,TF,F3,Coagulation factor III,CD142 |
Amino Acid | SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE |
Construction | 33-251 aa |
Protein Purity | >95% as determined by SDS-PAGE. |
Molecular Weight | 26.2 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.