Tissue Factor Protein, Human, Recombinant (Active, His)

Name: Tissue Factor Protein, Human, Recombinant (Active, His)
Brand: TargetMol
SKU: TMPH-04159
Rating: 4.5 (1 reviews)

(Synonyms: Tissue factor, Thromboplastin, TF, F3, Coagulation factor III, CD142) Copy Product Info

Synonyms: Tissue factor, Thromboplastin, TF, F3, Coagulation factor III, CD142

Catalog No. TMPH-04159 Copy Product Info

Tissue Factor Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is P13726.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$100	12 days	12 days
10 µg	$162	12 days	12 days
20 µg	$269	12 days	12 days
50 µg	$353	12 days	12 days
100 µg	$437	12 days	12 days
200 µg	$798	12 days	12 days
500 µg	$1,780	12 days	12 days
1 mg	$3,280	12 days	12 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human TF at 2 μg/mL can bind Anti-TF recombinant antibody (CSB-RA007928MA2HU). The EC50 is 1.434-1.635 ng/mL.
Description	Tissue Factor Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is P13726.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	P13726
Amino Acid	SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
Construction	33-251 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Tissue factor, Thromboplastin, TF, F3, Coagulation factor III, CD142

Chemical Properties

Molecular Weight

26.2 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

F 3CD 142

Related Tags: Tissue Factor Protein, Human, Recombinant (Active, His) chemical structure | Tissue Factor Protein, Human, Recombinant (Active, His) molecular weight