Shopping Cart
Remove All
Your shopping cart is currently empty
Tissue Factor Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is P13726.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $100 | 20 days | 20 days | |
| 10 μg | $162 | 20 days | 20 days | |
| 20 μg | $269 | 20 days | 20 days | |
| 50 μg | $353 | 20 days | 20 days | |
| 100 μg | $437 | 20 days | 20 days | |
| 200 μg | $798 | 20 days | 20 days | |
| 500 μg | $1,780 | 20 days | 20 days | |
| 1 mg | $3,280 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human TF at 2 μg/mL can bind Anti-TF recombinant antibody (CSB-RA007928MA2HU). The EC50 is 1.434-1.635 ng/mL. |
| Description | Tissue Factor Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is P13726. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-10xHis |
| Accession Number | P13726 |
| Synonyms | Tissue factor,Thromboplastin,TF,F3,Coagulation factor III,CD142 |
| Amino Acid | SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE |
| Construction | 33-251 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 26.2 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.