Shopping Cart
Remove All
Your shopping cart is currently empty
Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats. TDX Protein, Japonica rice, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 42.0 kDa and the accession number is Q6ES52.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $543 | 20 days | 20 days | |
| 100 μg | $745 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats. TDX Protein, Japonica rice, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 42.0 kDa and the accession number is Q6ES52. |
| Species | Rice |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | Q6ES52 |
| Synonyms | TPR repeat-containing thioredoxin TDX,Tetratricoredoxin (OsTDX),OsTrx26 |
| Amino Acid | MATAGASSFEDEIMESDIELEGEAVEPDNDPPQKMGDPSVEVSDEKRDQAQLCKNKGVDAFSEGKLDEAIEHLTEAIVLNPTSAIAYATRAVIFVKSKKPNAAIRDADAALKINPDSAKGYKSRGMAKAMLGKWEEAAQDLRMAAKLDYDEEIGAELKKVEPNVLKIEEHRKKYERLRKERDIKKAEMEKQRKHAEEVSAASAALKDGDVIAIHSSSELDTKLKAASSLSRLVVLYFTAAWCGPCRFIGPVCKSLAEKHRNVVFLKVDIDELNSVAYRWNVSSVPSFFFVRNGKEIDKVVGADKNGLERKVAQHGSS |
| Construction | 1-317 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 42.0 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.