Home Tools
Log in
Cart

SPase I Protein, E. coli, Recombinant (His & SUMO)

Catalog No. TMPH-00733
Synonyms: Leader peptidase I, Signal peptidase I, lepB

N/A. SPase I Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 43.7 kDa and the accession number is P00803.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
SPase I Protein, E. coli, Recombinant (His & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description N/A. SPase I Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 43.7 kDa and the accession number is P00803.
Species E. coli
Expression System E. coli
Tag N-6xHis-SUMO
Accession Number P00803
Synonyms Leader peptidase I, Signal peptidase I, lepB
Amino Acid RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
Construction 78-324 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 43.7 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background N/A

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

SPase I Protein, E. coli, Recombinant (His & SUMO) Leader peptidase I Signal peptidase I lepB recombinant recombinant-proteins proteins protein

 

TargetMol