Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Snaclec rhodocytin subunit beta, Rhodoaggretin subunit beta, Aggretin beta chain

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $129 | 20 days | 20 days | |
| 10 µg | $216 | 20 days | 20 days | |
| 20 µg | $360 | 20 days | 20 days | |
| 50 µg | $543 | 20 days | 20 days | |
| 100 µg | $745 | 20 days | 20 days | |
| 200 µg | $1,070 | 20 days | 20 days | |
| 500 µg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. Snaclec rhodocytin subunit beta Protein, Calloselasma rhodostoma, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 21.8 kDa and the accession number is Q9I840. |
| Species | Calloselasma rhodostoma |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | Q9I840 |
| Amino Acid | DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA |
| Construction | 24-146 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Snaclec rhodocytin subunit beta, Rhodoaggretin subunit beta, Aggretin beta chain |
| Research Background | Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. |
| Molecular Weight | 21.8 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.