SMAD3 Protein, Human, Recombinant (His)

Name: SMAD3 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01700
Rating: 4.5 (1 reviews)

(Synonyms: SMAD3, SMAD family member 3 (SMAD 3;Smad3;hSMAD3), Mothers against DPP homolog 3, Mothers against decapentaplegic homolog 3, MADH3, Mad3, MAD homolog 3, JV15-2, hMAD-3) Copy Product Info

Synonyms: SMAD3, SMAD family member 3 (SMAD 3;Smad3;hSMAD3), Mothers against DPP homolog 3, Mothers against decapentaplegic homolog 3, MADH3, Mad3, MAD homolog 3, JV15-2, hMAD-3

Catalog No. TMPH-01700 Copy Product Info

SMAD3 Protein, Human, Recombinant (His) is expressed in Baculovirus insect cells with N-10xHis tag. The predicted molecular weight is 50.6 kDa and the accession number is P84022.

Pack Size	Price	USA Stock	Global Stock
5 µg	$119	20 days	20 days
10 µg	$196	20 days	20 days
20 µg	$326	20 days	20 days
50 µg	$597	20 days	20 days
100 µg	$987	20 days	20 days
200 µg	$1,280	20 days	20 days
500 µg	$1,870	20 days	20 days
1 mg	$2,480	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SMAD3 Protein, Human, Recombinant (His) is expressed in Baculovirus insect cells with N-10xHis tag. The predicted molecular weight is 50.6 kDa and the accession number is P84022.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	N-10xHis
Accession Number	P84022
Amino Acid	MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Construction	1-425 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	SMAD3, SMAD family member 3 (SMAD 3;Smad3;hSMAD3), Mothers against DPP homolog 3, Mothers against decapentaplegic homolog 3, MADH3, Mad3, MAD homolog 3, JV15-2, hMAD-3
Research Background	Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.

Chemical Properties

Molecular Weight

50.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.