Shopping Cart
Remove All
Your shopping cart is currently empty
SLC19A1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $105 | 20 days | 20 days | |
| 10 μg | $169 | 20 days | 20 days | |
| 20 μg | $283 | 20 days | 20 days | |
| 50 μg | $428 | 20 days | 20 days | |
| 100 μg | $590 | 20 days | 20 days | |
| 200 μg | $913 | 20 days | 20 days | |
| 500 μg | $1,620 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | SLC19A1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P41440 |
| Synonyms | Solute carrier family 19 member 1 (hSLC19A1),SLC19A1,RFC1,Reduced folate transporter 1 (RFT-1),Reduced folate transporter,Reduced folate carrier protein (RFC;hRFC),Placental folate transporter,Intestinal folate carrier 1 (IFC-1),FOLT,Folate:anion antiporter SLC19A1,FLOT1,Cyclic dinucleotide:anion antiporter SLC19A1 |
| Amino Acid | DVRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ |
| Construction | 420-591 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 25.5 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Transporter that mediates the import of reduced folates and a subset of cyclic dinucleotides. Has high affinity for N5-methyltetrahydrofolate, the predominant circulating form of folate. Also able to mediate the import of antifolate drug methotrexate. Acts as an importer of immunoreactive cyclic dinucleotides, such as cyclic GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol, and its linkage isomer 3'-3'-cGAMP. Mechanistically, acts as an antiporter, which export of intracellular organic anions to facilitate uptake of its substrates. 5-amino-4-imidazolecarboxamide riboside (AICAR), when phosphorylated to AICAR monophosphate, can serve as an organic anion for antiporter activity. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.