Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His)

Copy Product Info

Synonyms:

Catalog No. TMPH-03491 Copy Product Info
SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His) is expressed in E. coli.
Pack SizePriceUSA StockGlobal StockQuantity
5 µg$7520 days20 days
10 µg$11920 days20 days
20 µg$19820 days20 days
50 µg$29720 days20 days
100 µg$42720 days20 days
200 µg$65820 days20 days
500 µg$1,17020 days20 days
1 mg$1,83020 days20 days
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Product Introduction

Bioactivity
Bioactivity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His) is expressed in E. coli.
Species
SARS-CoV-2
Expression System
E. coli
TagC-10xHis
Accession NumberYP_009742616.1
Amino AcidNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Construction1-113 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
ReconstitutionReconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Research Background
N/A
Chemical Properties
Molecular Weight13.9 kDa (predicted)
Storage & Solubility Information
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
StorageLyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Related Tags: SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His) chemical structure | SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His) molecular weight