RRAS2 Protein, Human, Recombinant (GST)

Name: RRAS2 Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-02005
Rating: 4.5 (1 reviews)

(Synonyms: Teratocarcinoma oncogene, TC21, RRAS2, Ras-related protein R-Ras2, Ras-like protein TC21) Copy Product Info

Synonyms: Teratocarcinoma oncogene, TC21, RRAS2, Ras-related protein R-Ras2, Ras-like protein TC21

Catalog No. TMPH-02005 Copy Product Info

RRAS2 Protein, Human, Recombinant (GST) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	RRAS2 Protein, Human, Recombinant (GST) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	P62070
Amino Acid	MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Construction	1-204 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Teratocarcinoma oncogene, TC21, RRAS2, Ras-related protein R-Ras2, Ras-like protein TC21
Research Background	GTP-binding protein with GTPase activity involved in the regulation of MAPK signaling pathway, thereby controlling multiple cellular processes. Involved in the regulation of MAPK signaling pathway. Regulation of craniofacial development.

Chemical Properties

Molecular Weight

50.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.