Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Rotavirus A (strain St. Thomas 3) VP4 Protein (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03425

Rotavirus A (strain St. Thomas 3) VP4 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.3 kDa and the accession number is P11200.

Rotavirus A (strain St. Thomas 3) VP4 Protein (His)

Rotavirus A (strain St. Thomas 3) VP4 Protein (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03425
Rotavirus A (strain St. Thomas 3) VP4 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.3 kDa and the accession number is P11200.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$59720 days20 days
100 μg$84520 days20 days
200 μg$1,19020 days20 days
500 μg$1,95020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Rotavirus A (strain St. Thomas 3) VP4 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.3 kDa and the accession number is P11200.
Species
RV-A
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP11200
Synonyms
Outer capsid protein VP4,Hemagglutinin
Amino Acid
AQVSEDIIISKTSLWKEMQYNRDIIIRFKFNNSIIKLGGLGYKWSEISFKAANYQYNYLRDGEQVTAHTTCSVNGVNNFSYNGGLLPTHFSISRYEVIKENSYVYVDYWDDSQAFRNMVYVRSLAANLNSVKCSGGNYNFQMPVGAWPVMSGGAVSLHFAGVTLSTQFTDFVSLNSLRFRFSLTVEEPPFSILRTRVSGLYGLPASNPNSGHEYYEIAGRFSLISLVPSNDDY
Construction
247-479 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight28.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. It is subsequently lost, together with VP7, following virus entry into the host cell. Following entry into the host cell, low intracellular or intravesicular Ca(2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7. During the virus exit from the host cell, VP4 seems to be required to target the newly formed virions to the host cell lipid rafts.; Forms the spike 'foot' and 'body' and acts as a membrane permeabilization protein that mediates release of viral particles from endosomal compartments into the cytoplasm. During entry, the part of VP5* that protrudes from the virus folds back on itself and reorganizes from a local dimer to a trimer. This reorganization may be linked to membrane penetration by exposing VP5* hydrophobic region. In integrin-dependent strains, VP5* targets the integrin heterodimer ITGA2/ITGB1 for cell attachment.; Forms the head of the spikes and mediates the recognition of specific host cell surface glycans. It is the viral hemagglutinin and an important target of neutralizing antibodies. In sialic acid-dependent strains, VP8* binds to host cell sialic acid, most probably a ganglioside, providing the initial contact. In some other strains, VP8* mediates the attachment to histo-blood group antigens (HBGAs) for viral entry.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.