RNASE2 Protein, Human, Recombinant (His)

Name: RNASE2 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01779
Price: 75 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: RNS2, RNASE2, RNase UpI-2, Ribonuclease US, Ribonuclease 2 (RNase 2), Non-secretory ribonuclease, Eosinophil-derived neurotoxin, EDN) Copy Product Info

Synonyms: RNS2, RNASE2, RNase UpI-2, Ribonuclease US, Ribonuclease 2 (RNase 2), Non-secretory ribonuclease, Eosinophil-derived neurotoxin, EDN

Catalog No. TMPH-01779 Copy Product Info

This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities. RNASE2 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P10153.

RNASE2 Protein, Human, Recombinant (His)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	-	In Stock
10 µg	$119	-	In Stock
20 µg	$198	-	In Stock
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities. RNASE2 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P10153.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P10153
Amino Acid	KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Construction	28-161 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	RNS2, RNASE2, RNase UpI-2, Ribonuclease US, Ribonuclease 2 (RNase 2), Non-secretory ribonuclease, Eosinophil-derived neurotoxin, EDN
Research Background	This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.

Chemical Properties

Molecular Weight

19.5 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.