Ricin Protein, Ricinus communis, Recombinant

Name: Ricin Protein, Ricinus communis, Recombinant
Brand: TargetMol
SKU: TMPH-04407
Rating: 4.5 (1 reviews)

(Synonyms: Ricin) Copy Product Info

Synonyms: Ricin

Catalog No. TMPH-04407 Copy Product Info

Ricin Protein, Ricinus communis, Recombinant is expressed in E. coli. The accession number is P02879.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$198	20 days	20 days
10 µg	$342	20 days	20 days
20 µg	$575	20 days	20 days
50 µg	$755	20 days	20 days
100 µg	$928	20 days	20 days
200 µg	$1,280	20 days	20 days
500 µg	$1,970	20 days	20 days
1 mg	$2,730	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Ricin Protein, Ricinus communis, Recombinant is expressed in E. coli. The accession number is P02879.
Species	Ricinus communis
Expression System	E. coli
Tag	Tag Free
Accession Number	P02879
Amino Acid	IFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRCAPPPSSQF
Construction	36-302 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Ricin

Chemical Properties

Molecular Weight

30.1 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 44 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.