Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Ricin Protein, Ricinus communis, Recombinant

TargetMol | SPR
Catalog No. TMPH-04407

Ricin Protein, Ricinus communis, Recombinant is expressed in E. coli. The accession number is P02879.

Ricin Protein, Ricinus communis, Recombinant

Ricin Protein, Ricinus communis, Recombinant

TargetMol | SPR
Catalog No. TMPH-04407
Ricin Protein, Ricinus communis, Recombinant is expressed in E. coli. The accession number is P02879.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$19820 days20 days
10 μg$34220 days20 days
20 μg$57520 days20 days
50 μg$75520 days20 days
100 μg$92820 days20 days
200 μg$1,28020 days20 days
500 μg$1,97020 days20 days
1 mg$2,73020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Ricin Protein, Ricinus communis, Recombinant is expressed in E. coli. The accession number is P02879.
Species
Ricinus communis
Expression System
E. coli
TagTag Free
Accession NumberP02879
Synonyms
Ricin
Amino Acid
IFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRCAPPPSSQF
Construction
36-302 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight30.1 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 44 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.