Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Ribonuclease 4 Protein, Human, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02045 Copy Product Info
Ribonuclease 4 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

Ribonuclease 4 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-02045
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Ribonuclease 4 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

Ribonuclease 4 Protein, Human, Recombinant (His & Myc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$17620 days20 days
10 μg$29320 days20 days
20 μg$49120 days20 days
50 μg$92620 days20 days
100 μg$1,50020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Ribonuclease 4 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.
Species
Human
Expression System
Baculovirus Insect Cells
TagN-10xHis, C-Myc
Accession NumberP34096
Synonyms
RNS4,RNASE4,RNase 4,Ribonuclease 4
Amino Acid
QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG
Construction
29-147 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight17.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
This RNase has marked specificity towards the 3' side of uridine nucleotides.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords