Home Tools
Log in
Cart

Ribonuclease 4 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-02045

Ribonuclease 4 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Ribonuclease 4 Protein, Human, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 491.00
100 μg 20 days $ 1,370.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Ribonuclease 4 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.
Species Human
Expression System Baculovirus Insect Cells
Tag N-10xHis, C-Myc
Accession Number P34096
Amino Acid QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG
Construction 29-147 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 17.8 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background This RNase has marked specificity towards the 3' side of uridine nucleotides.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol