REG3A Protein, Human, Recombinant (GST)

Name: REG3A Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-02019
Rating: 4.5 (1 reviews)

(Synonyms: Regenerating islet-derived protein III-alpha (Reg III-alpha), Regenerating islet-derived protein 3-alpha, REG-3-alpha, REG3A, PAP1, PAP, Pancreatitis-associated protein 1, Human proislet peptide (HIP), HIP, Hepatointestinal pancreatic protein (HIP/PAP)) Copy Product Info

Synonyms: Regenerating islet-derived protein III-alpha (Reg III-alpha), Regenerating islet-derived protein 3-alpha, REG-3-alpha, REG3A, PAP1, PAP, Pancreatitis-associated protein 1, Human proislet peptide (HIP), HIP, Hepatointestinal pancreatic protein (HIP/PAP)

Catalog No. TMPH-02019 Copy Product Info

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. REG3A Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 43.6 kDa and the accession number is Q06141.

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. REG3A Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 43.6 kDa and the accession number is Q06141.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	Q06141
Amino Acid	EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Construction	27-175 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Regenerating islet-derived protein III-alpha (Reg III-alpha), Regenerating islet-derived protein 3-alpha, REG-3-alpha, REG3A, PAP1, PAP, Pancreatitis-associated protein 1, Human proislet peptide (HIP), HIP, Hepatointestinal pancreatic protein (HIP/PAP)
Research Background	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.

Chemical Properties

Molecular Weight

43.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.