PTPRB Protein, Human, Recombinant (His)

Name: PTPRB Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02010
Rating: 4.5 (1 reviews)

(Synonyms: Vascular endothelial protein tyrosine phosphatase (VE-PTP), R-PTP-beta, Receptor-type tyrosine-protein phosphatase beta, PTPRB, PTPB, Protein-tyrosine phosphatase beta) Copy Product Info

Synonyms: Vascular endothelial protein tyrosine phosphatase (VE-PTP), R-PTP-beta, Receptor-type tyrosine-protein phosphatase beta, PTPRB, PTPB, Protein-tyrosine phosphatase beta

Catalog No. TMPH-02010 Copy Product Info

PTPRB Protein, Human, Recombinant (His) is expressed in Yeast.

Pack Size	Price	USA Stock	Global Stock
5 µg	$86	20 days	20 days
10 µg	$138	20 days	20 days
20 µg	$231	20 days	20 days
50 µg	$348	20 days	20 days
100 µg	$480	20 days	20 days
200 µg	$743	20 days	20 days
500 µg	$1,330	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PTPRB Protein, Human, Recombinant (His) is expressed in Yeast.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P23467
Amino Acid	RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH
Construction	1643-1997 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Vascular endothelial protein tyrosine phosphatase (VE-PTP), R-PTP-beta, Receptor-type tyrosine-protein phosphatase beta, PTPRB, PTPB, Protein-tyrosine phosphatase beta
Research Background	Plays an important role in blood vessel remodeling and angiogenesis. Not necessary for the initial formation of blood vessels, but is essential for their maintenance and remodeling. Can induce dephosphorylation of TEK/TIE2, CDH5/VE-cadherin and KDR/VEGFR-2. Regulates angiopoietin-TIE2 signaling in endothelial cells. Acts as a negative regulator of TIE2, and controls TIE2 driven endothelial cell proliferation, which in turn affects blood vessel remodeling during embryonic development and determines blood vessel size during perinatal growth. Essential for the maintenance of endothelial cell contact integrity and for the adhesive function of VE-cadherin in endothelial cells and this requires the presence of plakoglobin.

Chemical Properties

Molecular Weight

43.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.