Shopping Cart
- Remove All
- Your shopping cart is currently empty
May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors. PTPN5 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 45.5 kDa and the accession number is P54829.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $75 | 20 days | |
10 μg | $119 | 20 days | |
20 μg | $198 | 20 days | |
50 μg | $297 | 20 days | |
100 μg | $427 | 20 days | |
200 μg | $658 | 20 days | |
500 μg | $1,170 | 20 days | |
1 mg | $1,830 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors. PTPN5 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 45.5 kDa and the accession number is P54829. |
Species | Human |
Expression System | E. coli |
Tag | N-6xHis-SUMO |
Accession Number | P54829 |
Synonyms | Tyrosine-protein phosphatase non-receptor type 5,Striatum-enriched protein-tyrosine phosphatase (STEP),PTPN5,Neural-specific protein-tyrosine phosphatase |
Amino Acid | LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY |
Construction | 300-555 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 45.5 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.