Shopping Cart
Remove All
Your shopping cart is currently empty
PTH1R Protein, Macaca fascicularis, Recombinant (His)
Catalog No. TMPH-04528
PTH1R Protein, Macaca fascicularis, Recombinant (His) is expressed in Mammalian cell. The accession number is A0A2K5V724.
PTH1R Protein, Macaca fascicularis, Recombinant (His)
Catalog No. TMPH-04528
PTH1R Protein, Macaca fascicularis, Recombinant (His) is expressed in Mammalian cell. The accession number is A0A2K5V724.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $56 | 20 days | 20 days | |
| 10 μg | $88 | 20 days | 20 days | |
| 20 μg | $143 | 20 days | 20 days | |
| 50 μg | $238 | 20 days | 20 days | |
| 100 μg | $357 | 20 days | 20 days | |
| 200 μg | $643 | 20 days | 20 days | |
| 500 μg | $1,390 | 20 days | 20 days | |
| 1 mg | $2,580 | 20 days | 20 days |
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | PTH1R Protein, Macaca fascicularis, Recombinant (His) is expressed in Mammalian cell. The accession number is A0A2K5V724. |
| Species | Cynomolgus monkey |
| Expression System | HEK293 Cells |
| Tag | C-10xHis |
| Accession Number | A0A2K5V724 |
| Synonyms | PTH1R,PTH/PTHrP type I receptor,Parathyroid hormone/parathyroid hormone-related peptide receptor,Parathyroid hormone 1 receptor |
| Amino Acid | DDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPANIMESDKGWTSTSTSGKPRKDKPSGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG |
| Construction | 29-188 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Molecular Weight | 19.9 kDa (Predicted) |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 165 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.