Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat Nb2-11 cells is less than 1.0 ng/ml, corresponding to a specific activity of ＞ 1.0 ×106 IU/mg.

Prolactin Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P06879.

Mouse

E. coli

Prolactin,PRL,Prl

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

30-226 aa

>98% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.