Shopping Cart
Remove All
Your shopping cart is currently empty
Prolactin Protein, Mouse, Recombinant
Catalog No. TMPH-04316 Copy Product Info
Prolactin Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P06879.
Prolactin Protein, Mouse, Recombinant
Catalog No. TMPH-04316
Copy Product InfoProlactin Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P06879.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $92 | 7-10 days | 7-10 days | |
| 10 μg | $147 | 7-10 days | 7-10 days | |
| 20 μg | $223 | 7-10 days | 7-10 days | |
| 50 μg | $393 | 7-10 days | 7-10 days | |
| 100 μg | $613 | 7-10 days | 7-10 days | |
| 200 μg | $857 | 7-10 days | 7-10 days | |
| 500 μg | $1,330 | 7-10 days | 7-10 days |
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat Nb2-11 cells is less than 1.0 ng/ml, corresponding to a specific activity of ＞ 1.0 ×106 IU/mg. |
| Description | Prolactin Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P06879. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P06879 |
| Synonyms | Prolactin,PRL |
| Amino Acid | LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC |
| Construction | 30-226 aa |
| Protein Purity | >98% as determined by SDS-PAGE. |
| Molecular Weight | 22.4 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.