Shopping Cart
- Remove All
- Your shopping cart is currently empty
PRDX1 Protein, Cricetulus griseus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is Q9JKY1.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $143 | 20 days | |
10 μg | $238 | 20 days | |
20 μg | $397 | 20 days | |
50 μg | $597 | 20 days | |
100 μg | $845 | 20 days | |
200 μg | $1,190 | 20 days | |
500 μg | $1,950 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | PRDX1 Protein, Cricetulus griseus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is Q9JKY1. |
Species | Chinese hamster |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis |
Accession Number | Q9JKY1 |
Synonyms | Thioredoxin-dependent peroxiredoxin 1,Thioredoxin peroxidase 2 (TPX-2),TDPX2,PRDX1,Peroxiredoxin-1 |
Amino Acid | SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
Construction | 2-199 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 24.2 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.