PPP2CA Protein, Human, Recombinant (His & Myc)

Name: PPP2CA Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-02096
Rating: 4.5 (1 reviews)

(Synonyms: Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform, Replication protein C (RP-C), PPP2CA, PP2A-alpha) Copy Product Info

Synonyms: Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform, Replication protein C (RP-C), PPP2CA, PP2A-alpha

Catalog No. TMPH-02096 Copy Product Info

PPP2CA Protein, Human, Recombinant (His & Myc) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PPP2CA Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P67775
Amino Acid	MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Construction	1-309 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform, Replication protein C (RP-C), PPP2CA, PP2A-alpha
Research Background	PP2A is the major phosphatase for microtubule-associated proteins (MAPs). PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Cooperates with SGO2 to protect centromeric cohesin from separase-mediated cleavage in oocytes specifically during meiosis I. Can dephosphorylate SV40 large T antigen and p53/TP53. Activates RAF1 by dephosphorylating it at 'Ser-259'. Mediates dephosphorylation of WEE1, preventing its ubiquitin-mediated proteolysis, increasing WEE1 protein levels, and promoting the G2/M checkpoint. Mediates dephosphorylation of MYC; promoting its ubiquitin-mediated proteolysis: interaction with AMBRA1 enhances interaction between PPP2CA and MYC. Mediates dephosphorylation of FOXO3; promoting its stabilization: interaction with AMBRA1 enhances interaction between PPP2CA and FOXO3.

Chemical Properties

Molecular Weight

43.0 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.